PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_00820
Common NameKK1_000843
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 252aa    MW: 28700.2 Da    PI: 6.7854
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_00820genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.3e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed ll ++++ +G g+Wk+ +++ g+ R++k+c++rw +yl
    C.cajan_00820 14 KGPWTPKEDALLTKYIQAHGEGQWKSLPKKAGLLRCGKSCRLRWMNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding53.36.4e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ T+eEd+l+++ + +lG++ W++Ia +++ gRt++++k++w+++l
    C.cajan_00820  67 RGNITAEEDDLIIRMHSLLGNR-WSLIAGRLP-GRTDNEIKNYWNTHL 112
                      7999******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.536961IPR017930Myb domain
SuperFamilySSF466893.08E-3011108IPR009057Homeodomain-like
SMARTSM007175.2E-131363IPR001005SANT/Myb domain
PfamPF002494.2E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-251568IPR009057Homeodomain-like
CDDcd001673.46E-101661No hitNo description
PROSITE profilePS5129426.88662116IPR017930Myb domain
SMARTSM007171.4E-1666114IPR001005SANT/Myb domain
PfamPF002494.0E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-2669115IPR009057Homeodomain-like
CDDcd001671.87E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MGRAPCCSKV GLHKGPWTPK EDALLTKYIQ AHGEGQWKSL PKKAGLLRCG KSCRLRWMNY  60
LRPDIKRGNI TAEEDDLIIR MHSLLGNRWS LIAGRLPGRT DNEIKNYWNT HLSKKKKKGS  120
TNTNADEAPK TQVYLPKPIR VKAMYLARTD SNTFTFDSNS PSGSTSQEEK EECPVTKESN  180
MVSEVGNEGE SDGFGFFSVD HDLVNASDIE CHSYFHTEDH GTLQKVYEEY FQLLNMDHAQ  240
FDINSYEDFL LE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-271211525127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0963971e-146BT096397.1 Soybean clone JCVI-FLGm-20P11 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001238271.11e-153MYB transcription factor MYB92
SwissprotQ9SZP14e-65MYB4_ARATH; Transcription repressor MYB4
TrEMBLA0A151SIQ00.0A0A151SIQ0_CAJCA; Transcription repressor MYB4
STRINGGLYMA16G02570.11e-153(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.12e-65myb domain protein 4